Assay ID | Title | Year | Journal | Article |
AID1347159 | Primary screen GU Rhodamine qHTS for Zika virus inhibitors: Unlinked NS2B-NS3 protease assay | 2020 | Proceedings of the National Academy of Sciences of the United States of America, 12-08, Volume: 117, Issue:49
| Therapeutic candidates for the Zika virus identified by a high-throughput screen for Zika protease inhibitors. |
AID1347411 | qHTS to identify inhibitors of the type 1 interferon - major histocompatibility complex class I in skeletal muscle: primary screen against the NCATS Mechanism Interrogation Plate v5.0 (MIPE) Libary | 2020 | ACS chemical biology, 07-17, Volume: 15, Issue:7
| High-Throughput Screening to Identify Inhibitors of the Type I Interferon-Major Histocompatibility Complex Class I Pathway in Skeletal Muscle. |
AID1296008 | Cytotoxic Profiling of Annotated Libraries Using Quantitative High-Throughput Screening | 2020 | SLAS discovery : advancing life sciences R & D, 01, Volume: 25, Issue:1
| Cytotoxic Profiling of Annotated and Diverse Chemical Libraries Using Quantitative High-Throughput Screening. |
AID1346987 | P-glycoprotein substrates identified in KB-8-5-11 adenocarcinoma cell line, qHTS therapeutic library screen | 2019 | Molecular pharmacology, 11, Volume: 96, Issue:5
| A High-Throughput Screen of a Library of Therapeutics Identifies Cytotoxic Substrates of P-glycoprotein. |
AID1346986 | P-glycoprotein substrates identified in KB-3-1 adenocarcinoma cell line, qHTS therapeutic library screen | 2019 | Molecular pharmacology, 11, Volume: 96, Issue:5
| A High-Throughput Screen of a Library of Therapeutics Identifies Cytotoxic Substrates of P-glycoprotein. |
AID1347160 | Primary screen NINDS Rhodamine qHTS for Zika virus inhibitors | 2020 | Proceedings of the National Academy of Sciences of the United States of America, 12-08, Volume: 117, Issue:49
| Therapeutic candidates for the Zika virus identified by a high-throughput screen for Zika protease inhibitors. |
AID1347103 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for OHS-50 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1745845 | Primary qHTS for Inhibitors of ATXN expression | | | |
AID1347104 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for RD cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347107 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for Rh30 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347090 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for DAOY cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347154 | Primary screen GU AMC qHTS for Zika virus inhibitors | 2020 | Proceedings of the National Academy of Sciences of the United States of America, 12-08, Volume: 117, Issue:49
| Therapeutic candidates for the Zika virus identified by a high-throughput screen for Zika protease inhibitors. |
AID1347093 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for SK-N-MC cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347095 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for NB-EBc1 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347105 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for MG 63 (6-TG R) cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347108 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for Rh41 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347100 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for LAN-5 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347099 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for NB1643 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347106 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for control Hh wild type fibroblast cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347089 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for TC32 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347101 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for BT-12 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347097 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for Saos-2 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347082 | qHTS for Inhibitors of the Functional Ribonucleoprotein Complex (vRNP) of Lassa (LASV) Arenavirus: LASV Primary Screen - GLuc reporter signal | 2020 | Antiviral research, 01, Volume: 173 | A cell-based, infectious-free, platform to identify inhibitors of lassa virus ribonucleoprotein (vRNP) activity. |
AID1347094 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for BT-37 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347092 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for A673 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347091 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for SJ-GBM2 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347083 | qHTS for Inhibitors of the Functional Ribonucleoprotein Complex (vRNP) of Lassa (LASV) Arenavirus: Viability assay - alamar blue signal for LASV Primary Screen | 2020 | Antiviral research, 01, Volume: 173 | A cell-based, infectious-free, platform to identify inhibitors of lassa virus ribonucleoprotein (vRNP) activity. |
AID1347098 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for SK-N-SH cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347096 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for U-2 OS cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347102 | qHTS of pediatric cancer cell lines to identify multiple opportunities for drug repurposing: Primary screen for Rh18 cells | 2018 | Oncotarget, Jan-12, Volume: 9, Issue:4
| Quantitative high-throughput phenotypic screening of pediatric cancer cell lines identifies multiple opportunities for drug repurposing. |
AID1347086 | qHTS for Inhibitors of the Functional Ribonucleoprotein Complex (vRNP) of Lymphocytic Choriomeningitis Arenaviruses (LCMV): LCMV Primary Screen - GLuc reporter signal | 2020 | Antiviral research, 01, Volume: 173 | A cell-based, infectious-free, platform to identify inhibitors of lassa virus ribonucleoprotein (vRNP) activity. |
AID1508630 | Primary qHTS for small molecule stabilizers of the endoplasmic reticulum resident proteome: Secreted ER Calcium Modulated Protein (SERCaMP) assay | 2021 | Cell reports, 04-27, Volume: 35, Issue:4
| A target-agnostic screen identifies approved drugs to stabilize the endoplasmic reticulum-resident proteome. |
AID729475 | Antiproliferative activity against human T47D cells harboring PI3KCA mutant after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID737126 | Antiproliferative activity against PTEN-deficient human U87 cells after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID737127 | Antiproliferative activity against human NCI-H1915 cells harboring KRAS mutant after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1815430 | Cytotoxicity against human IGROV-1 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID737129 | Antiproliferative activity against human HCT116 cells harboring PI3KCA/KRAS double mutant after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID729478 | Antiproliferative activity against human MDA-MB-453 cells harboring PI3KCA mutant after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1815438 | Cytotoxicity against human 6647 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID1815429 | Cytotoxicity against human 786-0 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID737117 | Inhibition of PDK1 autophosphorylation at ser241 in human PC3 cells at 5 uM measured at 48 hrs | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID641893 | Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence-based spectrophotometry | 2011 | Journal of medicinal chemistry, Dec-22, Volume: 54, Issue:24
| Discovery of novel, potent, and selective inhibitors of 3-phosphoinositide-dependent kinase (PDK1). |
AID737135 | Antiproliferative activity against PTEN-deficient human NCI-H446 cells after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1815435 | Cytotoxicity against human REC1 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID1815427 | Cytotoxicity against human MCF7 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID737131 | Antiproliferative activity against human A427 cells harboring KRAS mutant after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID737125 | Antiproliferative activity against human MCF7 cells harboring PI3KCA mutant after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1815414 | Cytotoxicity against human NCI-H69 cells at 30 uM assessed as cell proliferation rate measured after 72 hrs by MTT assay relative to control | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID729476 | Antiproliferative activity against human UMC11 cells after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1815432 | Cytotoxicity against human HCT-116 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID737133 | Antiproliferative activity against PTEN-deficient human PC3 cells after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID729477 | Antiproliferative activity against human MDA-MB-231 cells harboring KRAS mutant after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1310404 | Antiproliferative activity against human U87MG cells after 72 hrs | 2016 | European journal of medicinal chemistry, Aug-08, Volume: 118 | Locking PDK1 in DFG-out conformation through 2-oxo-indole containing molecules: Another tools to fight glioblastoma. |
AID1815446 | Cytotoxicity against human TC-32 cells at 30 uM assessed as cell proliferation rate measured after 72 hrs by MTT assay relative to control | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID737134 | Antiproliferative activity against human BT474 cells harboring PI3KCA mutant after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID737130 | Antiproliferative activity against human NCI-H1437 cells after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1815440 | Cytotoxicity against human A673 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID1815428 | Cytotoxicity against human CAKI-1 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID737128 | Antiproliferative activity against human LS513 cells harboring KRAS mutant after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1815434 | Cytotoxicity against human NCI-H82 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID729474 | Antiproliferative activity against PTEN-deficient human LNCAP cells after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1815433 | Cytotoxicity against human NCI-H69 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID1815431 | Cytotoxicity against human PC-3 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID737132 | Antiproliferative activity against human A549 cells harboring KRAS mutant after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1815436 | Cytotoxicity against human TC-32 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID1815439 | Cytotoxicity against human TC71 cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID729479 | Antiproliferative activity against PTEN-deficient human A27801 cells after 72 hrs by ATP ViaLight assay | 2013 | Journal of medicinal chemistry, Apr-11, Volume: 56, Issue:7
| Selective 3-phosphoinositide-dependent kinase 1 (PDK1) inhibitors: dissecting the function and pharmacology of PDK1. |
AID1815437 | Cytotoxicity against human SK-N-MC cells measured after 72 hrs by MTT assay | 2021 | European journal of medicinal chemistry, Dec-15, Volume: 226 | Development of potent dual PDK1/AurA kinase inhibitors for cancer therapy: Lead-optimization, structural insights, and ADME-Tox profile. |
AID977608 | Experimentally measured binding affinity data (IC50) for protein-ligand complexes derived from PDB | 2011 | Bioorganic & medicinal chemistry letters, May-15, Volume: 21, Issue:10
| Discovery of a potent and highly selective PDK1 inhibitor via fragment-based drug discovery. |
[information is prepared from bioassay data collected from National Library of Medicine (NLM), extracted Dec-2023] |